RetrogeneDB ID: | retro_ptro_757 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 12:40857968..40858344(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BOD1 | ||
Ensembl ID: | ENSPTRG00000017544 | ||
Aliases: | None | ||
Description: | biorientation of chromosomes in cell division 1 [Source:HGNC Symbol;Acc:25114] |
Percent Identity: | 66.41 % |
Parental protein coverage: | 87.5 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | SQASAGASRGLFDSFRRDCLADVDTKPAYQN-LRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSVVQS |
...S.....G.F.SFRR.CLA.VDTKPAYQN.LRQK....VSTHLDKQEWNPTM.KN.LR.GLRQSV.QS | |
Retrocopy | TRRSSWSGSGPFSSFRRCCLAPVDTKPAYQN<LRQKAQHSVSTHLDKQEWNPTMRKN*LRSGLRQSVFQS |
Parental | GMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAQKKAAVPAP-PPEPEGQDPPA |
G.L.AGVD....Q.VDP.LNHI.RP..E.AIHE.L.AQK.A.VP.P.P.EP..Q.PPA | |
Retrocopy | GTLKAGVDGVLYQMVDPELNHIPRPPVE*AIHEILGAQKTAMVPVP<PSEPKDQYPPA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .07 RPM | 8 .01 RPM |
SRP007412_cerebellum | 0 .22 RPM | 10 .22 RPM |
SRP007412_heart | 0 .00 RPM | 10 .14 RPM |
SRP007412_kidney | 0 .08 RPM | 8 .76 RPM |
SRP007412_liver | 0 .00 RPM | 8 .48 RPM |
SRP007412_testis | 0 .11 RPM | 24 .66 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_993 |
Gorilla gorilla | retro_ggor_794 |
Macaca mulatta | retro_mmul_803 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000034598 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000016776 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000031971 | 4 retrocopies | |
Homo sapiens | ENSG00000145919 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000010925 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000002626 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000013793 | 2 retrocopies | |
Mus musculus | ENSMUSG00000044502 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000476 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000014283 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000001107 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000016057 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000017544 | 2 retrocopies |
retro_ptro_1282, retro_ptro_757 ,
|
Ictidomys tridecemlineatus | ENSSTOG00000013505 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000014046 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007617 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000000384 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000004260 | 1 retrocopy |