RetrogeneDB ID: | retro_ggor_1365 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 18:3428021..3428461(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSGGOG00000025977 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BOD1 | ||
Ensembl ID: | ENSGGOG00000010925 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 67.11 % |
Parental protein coverage: | 80. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | GGGGPINPASLPPGDPQLIALIVEQLKSR-GLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEW |
G..G...PA.LP.GDP.LIALI.E.LKS..G.F.SF.R.CLA.VDTKPAYQN.RQK.....STHLD.Q.W | |
Retrocopy | GNAGTMIPA-LPSGDPELIALILEWLKSQ<GPFGSFCRCCLAPVDTKPAYQNRRQKAERSASTHLDEQNW |
Parental | NPTMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAQKKAAVPAPPPEP |
...M.K..LRNG.RQS.VQSG.LEAGVDR.ISQ..DPKLNHI.RP..E.A.HEFL.AQK.A.VPAPP.EP | |
Retrocopy | SLMMRKSLLRNGQRQSEVQSGTLEAGVDRVISQAEDPKLNHILRPPMEGASHEFLGAQKTAMVPAPPLEP |
Parental | EGQDPPAPS |
..QDPPAP. | |
Retrocopy | ADQDPPAPA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 28 .92 RPM |
SRP007412_cerebellum | 0 .00 RPM | 21 .08 RPM |
SRP007412_heart | 0 .00 RPM | 11 .91 RPM |
SRP007412_kidney | 0 .00 RPM | 34 .76 RPM |
SRP007412_liver | 0 .00 RPM | 21 .13 RPM |
SRP007412_testis | 0 .00 RPM | 50 .87 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1867 |
Pan troglodytes | retro_ptro_1282 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000034598 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000016776 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000031971 | 4 retrocopies | |
Homo sapiens | ENSG00000145919 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000010925 | 2 retrocopies |
retro_ggor_1365 , retro_ggor_794,
|
Microcebus murinus | ENSMICG00000002626 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000013793 | 2 retrocopies | |
Mus musculus | ENSMUSG00000044502 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000476 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000014283 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000001107 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000016057 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000017544 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000013505 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000014046 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007617 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000000384 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000004260 | 1 retrocopy |