RetrogeneDB ID: | retro_ptro_1282 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 18:13236524..13236920(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BOD1 | ||
| Ensembl ID: | ENSPTRG00000017544 | ||
| Aliases: | None | ||
| Description: | biorientation of chromosomes in cell division 1 [Source:HGNC Symbol;Acc:25114] |
| Percent Identity: | 64.39 % |
| Parental protein coverage: | 91.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GGGTSQASAGASRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSV |
| G...S........G.F.SF.R.CLA.VDTKPAYQN.R.K....VSTHLD.Q.WN..M.K..LRNG.RQS. | |
| Retrocopy | GAHCSHPGVAQEPGPFGSFCRCCLAPVDTKPAYQNWRRKAERSVSTHLDEQNWNLMMRKSLLRNGQRQSE |
| Parental | VQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAQKKAAVPAPPPEPEGQDPPAPS |
| VQSG.LEAGVDR.ISQ..DPKLNHI.RP..E.A.HEFL.AQK.A.VPAPP.EP..QDPPAP. | |
| Retrocopy | VQSGTLEAGVDRVISQAEDPKLNHILRPPMEGASHEFLGAQKTAMVPAPPLEPADQDPPAPA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 8 .01 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 10 .22 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .14 RPM |
| SRP007412_kidney | 0 .00 RPM | 8 .76 RPM |
| SRP007412_liver | 0 .00 RPM | 8 .48 RPM |
| SRP007412_testis | 0 .00 RPM | 24 .66 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1867 |
| Gorilla gorilla | retro_ggor_1365 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000034598 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000016776 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000031971 | 4 retrocopies | |
| Homo sapiens | ENSG00000145919 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010925 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000002626 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013793 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000044502 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000476 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000014283 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001107 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000016057 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000017544 | 2 retrocopies |
retro_ptro_1282 , retro_ptro_757,
|
| Ictidomys tridecemlineatus | ENSSTOG00000013505 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014046 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007617 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000384 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000004260 | 1 retrocopy |