RetrogeneDB ID: | retro_ptro_906 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 14:40551011..40551283(+) | ||
| Located in intron of: | ENSPTRG00000006300 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FKBP1B | ||
| Ensembl ID: | ENSPTRG00000011708 | ||
| Aliases: | None | ||
| Description: | Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:H2QHI6] |
| Percent Identity: | 67.39 % |
| Parental protein coverage: | 84.26 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATG |
| KK.Q.CV..Y.G..QNG.KFD.S.DRNKPFKF..G.QEVI.GFEE..AQMSLGQ..KLTC..DV.Y.A.G | |
| Retrocopy | KKSQMCVAQYIGVFQNGNKFDLSEDRNKPFKFKTGEQEVINGFEEYIAQMSLGQKVKLTCICDVSYRAPG |
| Parental | HPGVIPPNATL-IFDVELLNLE |
| ....IPP.ATL.IFD.ELLNLE | |
| Retrocopy | YSSIIPPSATL<IFDMELLNLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 17 .37 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 6 .38 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .38 RPM |
| SRP007412_kidney | 0 .00 RPM | 1 .83 RPM |
| SRP007412_liver | 0 .00 RPM | 2 .16 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .53 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1329 |
| Gorilla gorilla | retro_ggor_1036 |
| Pongo abelii | retro_pabe_1105 |
| Macaca mulatta | retro_mmul_2171 |
| Callithrix jacchus | retro_cjac_696 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002797 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007700 | 1 retrocopy | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015664 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000013920 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000018990 | 2 retrocopies | |
| Homo sapiens | ENSG00000119782 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000010689 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000001530 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012341 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000800 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012604 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000004529 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000011708 | 1 retrocopy |
retro_ptro_906 ,
|
| Pan troglodytes | ENSPTRG00000013163 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000013808 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012282 | 1 retrocopy |