RetrogeneDB ID: | retro_pabe_1105 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 14:41730300..41730572(+) | ||
| Located in intron of: | ENSPPYG00000005771 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FKBP1B | ||
| Ensembl ID: | ENSPPYG00000012604 | ||
| Aliases: | None | ||
| Description: | FK506 binding protein 1B, 12.6 kDa [Source:HGNC Symbol;Acc:3712] |
| Percent Identity: | 69.57 % |
| Parental protein coverage: | 84.26 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATG |
| KK.Q.CV.HY.GM.QNG..FD.S.DRNKPFKF..G.QEVI.GFEE..AQMSLGQ..KLTC..DV.Y.A.G | |
| Retrocopy | KKSQMCVAHYIGMFQNGDRFDLSQDRNKPFKFKTGEQEVINGFEEYLAQMSLGQKVKLTCIHDVSYRAPG |
| Parental | HPGVIPPNATL-IFDVELLNLE |
| ...VIPP.ATL.IFD.ELLNLE | |
| Retrocopy | YSSVIPPSATL<IFDMELLNLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 25 .60 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 40 .37 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .72 RPM |
| SRP007412_kidney | 0 .00 RPM | 1 .13 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .43 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1329 |
| Pan troglodytes | retro_ptro_906 |
| Gorilla gorilla | retro_ggor_1036 |
| Macaca mulatta | retro_mmul_2171 |
| Callithrix jacchus | retro_cjac_696 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007700 | 1 retrocopy | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015664 | 1 retrocopy | |
| Homo sapiens | ENSG00000119782 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000010689 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012341 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000800 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004149 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000010852 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000012604 | 1 retrocopy |
retro_pabe_1105 ,
|
| Pan troglodytes | ENSPTRG00000011708 | 1 retrocopy |