RetrogeneDB ID: | retro_ecab_752 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 30:23478608..23478790(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FKBP1B | ||
| Ensembl ID: | ENSECAG00000015664 | ||
| Aliases: | None | ||
| Description: | FK506 binding protein 1B, 12.6 kDa [Source:HGNC Symbol;Acc:3712] |
Retrocopy-Parental alignment summary:
>retro_ecab_752
ACCTTTGCAAAGCTCCACCAGACATGCGTGGTGCATACAGCAGGATGCTTCAAGATGGAAAGAAATTTGATTCTTCCCAG
GATGGAAACAAGACAATTAAGTTTATGGTAGGCAAGCAGGAGGTGATCCGAGTCTAGGAAGGTGTGACCCAGATGAGGAT
GGGCCAGAGAGCTAAACTATCT
ORF - retro_ecab_752 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 65.08 % |
| Parental protein coverage: | 64.58 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | TFPKKGQTCVVH-YTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLT |
| TF.K..QTCVVH.Y..MLQ.GKKFDSS.D.NK..KF..GKQEVI....EG..QM..GQRAKL. | |
| Retrocopy | TFAKLHQTCVVH<YSRMLQDGKKFDSSQDGNKTIKFMVGKQEVIR-V*EGVTQMRMGQRAKLS |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 1 .24 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 22 .38 RPM |
| SRP021940_embryo | 0 .00 RPM | 10 .51 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 0 .67 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 2 .09 RPM |
| SRP021940_testis | 0 .00 RPM | 1 .02 RPM |
Equus caballus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_ecab_752 retrocopy.
Equus caballus was not studied using FANTOM5 data.
retro_ecab_752 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_ecab_752 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 10 parental genes, and 11 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007700 | 1 retrocopy | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015664 | 1 retrocopy |
retro_ecab_752 ,
|
| Equus caballus | ENSECAG00000018299 | 2 retrocopies | |
| Homo sapiens | ENSG00000119782 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000010689 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012341 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000800 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012604 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000011708 | 1 retrocopy |