RetrogeneDB ID: | retro_cjac_696 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 10:66345810..66346094(+) | ||
| Located in intron of: | ENSCJAG00000016083 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FKBP1B | ||
| Ensembl ID: | ENSCJAG00000007700 | ||
| Aliases: | None | ||
| Description: | FK506 binding protein 1B, 12.6 kDa [Source:HGNC Symbol;Acc:3712] |
| Percent Identity: | 63.54 % |
| Parental protein coverage: | 87.96 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | RTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAY |
| R...KK.QT.VV.Y.GMLQ.G.KFD.S.DRNKPFKF.IG..EVI..FEE....MSLG....LTC.PDVAY | |
| Retrocopy | RARAKKRQT*VVYYKGMLQHGNKFDLSQDRNKPFKFKIGE*EVISDFEEYIVLMSLGKKVNLTCIPDVAY |
| Parental | GATGHPGVIPPNATL-IFDVELLNLE |
| G..G...VIPP.ATL..FD.E.LNLE | |
| Retrocopy | GVPGYSSVIPPSATL<VFDMEPLNLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 0 .09 RPM |
| SRP051959_heart | 0 .04 RPM | 0 .70 RPM |
| SRP051959_kidney | 0 .00 RPM | 0 .33 RPM |
| SRP051959_liver | 0 .00 RPM | 0 .04 RPM |
| SRP051959_lung | 0 .00 RPM | 1 .06 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 0 .34 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .15 RPM |
| SRP051959_spleen | 0 .00 RPM | 0 .46 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1329 |
| Pan troglodytes | retro_ptro_906 |
| Gorilla gorilla | retro_ggor_1036 |
| Pongo abelii | retro_pabe_1105 |
| Macaca mulatta | retro_mmul_2171 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007700 | 1 retrocopy |
retro_cjac_696 ,
|
| Callithrix jacchus | ENSCJAG00000018746 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000020908 | 4 retrocopies | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015664 | 1 retrocopy | |
| Homo sapiens | ENSG00000119782 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000010689 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012341 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000800 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012604 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000011708 | 1 retrocopy |