RetrogeneDB ID: | retro_sara_338 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
Coordinates: | scaffold_170509:1458..1694(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PFDN6 | ||
Ensembl ID: | ENSSARG00000006330 | ||
Aliases: | None | ||
Description: | prefoldin subunit 6 [Source:HGNC Symbol;Acc:4926] |
Percent Identity: | 71.08 % |
Parental protein coverage: | 95.35 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG |
M.ELI.KK..GEVEKYQQ....LSK.MSGRQKLE..L.EN...KE.LAL.DGS.VVFKLLGP.LVKQEL. | |
Retrocopy | MTELI*KKQ*GEVEKYQQ---NLSKFMSGRQKLESHLIENDTMKEKLALQDGSDVVFKLLGPILVKQELR |
Parental | EARATVGK-RLDY |
E..AT.GK.RLDY | |
Retrocopy | EVQATLGK<RLDY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001576 | 2 retrocopies | |
Bos taurus | ENSBTAG00000010723 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000019520 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000013828 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000016778 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000000922 | 1 retrocopy | |
Mus musculus | ENSMUSG00000024309 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000010559 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000028341 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000000983 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000473 | 2 retrocopies | |
Sorex araneus | ENSSARG00000006330 | 2 retrocopies |
retro_sara_338 , retro_sara_453,
|
Tupaia belangeri | ENSTBEG00000013280 | 1 retrocopy |