RetrogeneDB ID: | retro_shar_740 | ||
Retrocopy location | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
| Coordinates: | GL861672.1:121721..122161(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C1orf43 | ||
| Ensembl ID: | ENSSHAG00000012915 | ||
| Aliases: | None | ||
| Description: | chromosome 1 open reading frame 43 [Source:HGNC Symbol;Acc:29876] |
| Percent Identity: | 54.67 % |
| Parental protein coverage: | 63.36 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected: | 3 |
| Parental | FVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSKVQDVKYEPQLLEEDDARLLQLETPG |
| FVLL.IF.K.QIM.FA.KS.R.PH.PV.HNA.KD.KEEI.I..SK..DV.YEP.LL....A..L.LET.. | |
| Retrocopy | FVLLSIFNKGQIMPFAIKSQRMPHIPVRHNATKDQKEEISIL*SKI*DVEYEP*LLRKNGASTLHLETQE |
| Parental | NQ-HCYNYLYRMKALDAIRASEIPFHSE-GRHPRSLMGKNFRSYLLELRNTSTPFKGV-RKALIDTLLDG |
| N...CYNYLYRMK.L....A..I.F..E......SLMG..F.S.LL.L.NT..P.K....KAL.D.LL.. | |
| Retrocopy | NN>YCYNYLYRMKVLGTPYACKILFQEE<NKYLPSLMG*HFHSCLLDL*NTNVPIKDL<HKALTDILLVW |
| Parental | YETARYGTGV |
| Y..A.YGT.. | |
| Retrocopy | YKKAQYGTNI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011865 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009722 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000019160 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000005454 | 1 retrocopy | |
| Equus caballus | ENSECAG00000017585 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000001056 | 15 retrocopies | |
| Macropus eugenii | ENSMEUG00000002600 | 6 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013338 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017237 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000027942 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000012008 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000007244 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000000785 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002717 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017758 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000012915 | 1 retrocopy |
retro_shar_740 ,
|
| Tupaia belangeri | ENSTBEG00000013866 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012777 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015824 | 1 retrocopy |