RetrogeneDB ID: | retro_sscr_696 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 3:42138296..42138566(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PCNP | ||
Ensembl ID: | ENSSSCG00000011955 | ||
Aliases: | None | ||
Description: | PEST proteolytic signal containing nuclear protein [Source:HGNC Symbol;Acc:30023] |
Percent Identity: | 65.22 % |
Parental protein coverage: | 50.56 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | TTKKASAISIKL-GSTKPKETVPTLAP-KTLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPN |
T.K.ASA...KL.GS.K.KET.P.LAP.KTL.VAAA..EDE.SEPE.MPPEA..RM.N....TPTSAGP. | |
Retrocopy | TAKNASATPSKL>GSSKAKETAPILAP<KTL*VAAALTEDEESEPEDMPPEATTRMENTAKVTPTSAGPD |
Parental | SFNKGKHGFSDNQKLWERNIKS |
.FN.GK.GF.D..KLWE.NI.S | |
Retrocopy | FFNEGKQGFPDDWKLWEQNIES |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 6 .64 RPM |
SRP014902_testis | 0 .00 RPM | 17 .54 RPM |
SRP018288_heart | 0 .00 RPM | 30 .57 RPM |
SRP018288_kidney | 0 .00 RPM | 28 .07 RPM |
SRP018288_liver | 0 .00 RPM | 18 .39 RPM |
SRP018288_lung | 0 .00 RPM | 37 .57 RPM |
SRP018856_adipose | 0 .00 RPM | 30 .57 RPM |
SRP035408_brain | 0 .00 RPM | 16 .86 RPM |
SRP035408_liver | 0 .00 RPM | 21 .90 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003777 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000009593 | 3 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000007972 | 11 retrocopies | |
Callithrix jacchus | ENSCJAG00000000508 | 6 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000008873 | 5 retrocopies | |
Felis catus | ENSFCAG00000029026 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025423 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000005518 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000005878 | 5 retrocopies | |
Macaca mulatta | ENSMMUG00000017782 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000011696 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000011110 | 7 retrocopies | |
Procavia capensis | ENSPCAG00000007007 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000009886 | 2 retrocopies | |
Sorex araneus | ENSSARG00000001433 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000011955 | 5 retrocopies | |
Tursiops truncatus | ENSTTRG00000015008 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000012239 | 1 retrocopy |