RetrogeneDB ID: | retro_cfam_2074 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | X:46554268..46554567(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PCNP | ||
| Ensembl ID: | ENSCAFG00000009593 | ||
| Aliases: | None | ||
| Description: | PEST proteolytic signal containing nuclear protein [Source:HGNC Symbol;Acc:30023] |
| Percent Identity: | 96.04 % |
| Parental protein coverage: | 57.47 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | TTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPPEAKMR-MKNIGRDTPTSAGPNS |
| TTKKASA.SIKLGSSKPKETVPTLAPKTLSVAAAFNED.DSEPEEMPPEAKMR.MKNIGRDTPTSAGPNS | |
| Retrocopy | TTKKASARSIKLGSSKPKETVPTLAPKTLSVAAAFNEDKDSEPEEMPPEAKMR<MKNIGRDTPTSAGPNS |
| Parental | FNKGKHGFSDNQKLWERNIKSHLGNVHDQDN |
| FNKGKHGFSDNQKLWE.NIKSHLGNVHDQDN | |
| Retrocopy | FNKGKHGFSDNQKLWEQNIKSHLGNVHDQDN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 84 .17 RPM |
| SRP017611_brain | 0 .00 RPM | 100 .99 RPM |
| SRP017611_kidney | 0 .00 RPM | 139 .47 RPM |
| SRP017611_liver | 0 .00 RPM | 28 .50 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003777 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000009593 | 3 retrocopies |
retro_cfam_1850, retro_cfam_2074 , retro_cfam_2160,
|
| Choloepus hoffmanni | ENSCHOG00000007972 | 11 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000508 | 6 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008873 | 5 retrocopies | |
| Felis catus | ENSFCAG00000029026 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025423 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000005518 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000005878 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000017782 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000011696 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000011110 | 7 retrocopies | |
| Procavia capensis | ENSPCAG00000007007 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000009886 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000001433 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000011955 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000015008 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000012239 | 1 retrocopy |