RetrogeneDB ID: | retro_amel_1111 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
Coordinates: | GL192913.1:587275..587547(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DYNLRB1 | ||
Ensembl ID: | ENSAMEG00000009179 | ||
Aliases: | None | ||
Description: | dynein, light chain, roadblock-type 1 [Source:HGNC Symbol;Acc:15468] |
Percent Identity: | 73.68 % |
Parental protein coverage: | 80.34 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | EVEETLKRLQSQK-GVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRI |
.VEETLK.L..QK.G..GI..VNTE.IPIKS.MD...TTQ.ANLMH.FILK..S..REI.PQNDLTFL.I | |
Retrocopy | KVEETLKPLPRQK<GSRGIMMVNTESIPIKSSMD---TTQHANLMHTFILKTWSAMREINPQNDLTFLQI |
Parental | RSKKNEIMVAPDKDYFLIVIQNPTE |
.SK.NEIMVAPDKDYFLIVIQN.TE | |
Retrocopy | CSKRNEIMVAPDKDYFLIVIQNLTE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009179 | 1 retrocopy |
retro_amel_1111 ,
|
Canis familiaris | ENSCAFG00000007547 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000018199 | 10 retrocopies | |
Equus caballus | ENSECAG00000008404 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000018637 | 2 retrocopies | |
Felis catus | ENSFCAG00000002304 | 1 retrocopy | |
Homo sapiens | ENSG00000125971 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000023900 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000029820 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000003253 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004820 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000031253 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000010082 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000021027 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000016802 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000010937 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000013416 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000014820 | 1 retrocopy |