RetrogeneDB ID: | retro_btau_1558 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 7:14810387..14810565(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HMGN3 | ||
Ensembl ID: | ENSBTAG00000001422 | ||
Aliases: | None | ||
Description: | High mobility group nucleosome-binding domain-containing protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q3ZBV4] |
Percent Identity: | 68.33 % |
Parental protein coverage: | 59. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKP-RKTSAKKEPAAKVSKG |
MPKRKSPENT.GKDGSKVT...PTR..AR.SAKPA...PEPKP....SAKKEP..K...G | |
Retrocopy | MPKRKSPENT*GKDGSKVTE*GPTRQFARFSAKPASSNPEPKP>XXXSAKKEPGTKSNIG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 49 .17 RPM |
ERP005899_muscle | 0 .00 RPM | 42 .34 RPM |
SRP017611_brain | 0 .00 RPM | 14 .11 RPM |
SRP017611_kidney | 0 .00 RPM | 59 .92 RPM |
SRP017611_liver | 0 .00 RPM | 13 .44 RPM |
SRP030211_testis | 0 .00 RPM | 36 .33 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011031 | 1 retrocopy | |
Bos taurus | ENSBTAG00000001422 | 2 retrocopies |
retro_btau_1524, retro_btau_1558 ,
|
Canis familiaris | ENSCAFG00000002809 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000007015 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000010800 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000018092 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016487 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016791 | 1 retrocopy |