RetrogeneDB ID: | retro_btau_1524 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 7:14958506..14958686(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HMGN3 | ||
| Ensembl ID: | ENSBTAG00000001422 | ||
| Aliases: | None | ||
| Description: | High mobility group nucleosome-binding domain-containing protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q3ZBV4] |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 59.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKP-RKTSAKKEPAAKVSKG |
| MPKRKSPENT.GKDGSK.T...PTR..AR.SAKPA...PEPKP....SAKKEP..K...G | |
| Retrocopy | MPKRKSPENT*GKDGSKLTE*GPTRQFARFSAKPASSNPEPKPXXXXSAKKEPGTKSNIG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 49 .17 RPM |
| ERP005899_muscle | 0 .00 RPM | 42 .34 RPM |
| SRP017611_brain | 0 .00 RPM | 14 .11 RPM |
| SRP017611_kidney | 0 .00 RPM | 59 .92 RPM |
| SRP017611_liver | 0 .00 RPM | 13 .44 RPM |
| SRP030211_testis | 0 .00 RPM | 36 .33 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011031 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000001422 | 2 retrocopies |
retro_btau_1524 , retro_btau_1558,
|
| Canis familiaris | ENSCAFG00000002809 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007015 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000010800 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000018092 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016487 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016791 | 1 retrocopy |