RetrogeneDB ID: | retro_pabe_421 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 1:99171281..99171472(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HMGN3 | ||
Ensembl ID: | ENSPPYG00000016791 | ||
Aliases: | None | ||
Description: | high mobility group nucleosome-binding domain-containing protein 3 [Source:RefSeq peptide;Acc:NP_001125217] |
Percent Identity: | 80. % |
Parental protein coverage: | 51.61 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MPKRKSPENTE-DKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKK |
M..RKSPEN.E..KDGSKVTKQEPTR.S.RLSAKP.PPKP.PKPR.T.AKKEPGAK.SRGAK.KK | |
Retrocopy | MQNRKSPENIE<GKDGSKVTKQEPTRWSPRLSAKPPPPKPGPKPRRTFAKKEPGAKVSRGAKEKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 25 .65 RPM |
SRP007412_cerebellum | 0 .00 RPM | 63 .23 RPM |
SRP007412_heart | 0 .00 RPM | 69 .78 RPM |
SRP007412_kidney | 0 .00 RPM | 50 .81 RPM |
SRP007412_liver | 0 .00 RPM | 25 .71 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_231 |
Pan troglodytes | retro_ptro_200 |
Macaca mulatta | retro_mmul_414 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011031 | 1 retrocopy | |
Bos taurus | ENSBTAG00000001422 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000002809 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000007015 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000010800 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000018092 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016487 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016791 | 1 retrocopy |
retro_pabe_421 ,
|