RetrogeneDB ID: | retro_btau_1723 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | GJ059769.1:715..944(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CCDC58 | ||
Ensembl ID: | ENSBTAG00000011138 | ||
Aliases: | None | ||
Description: | Coiled-coil domain-containing protein 58 [Source:UniProtKB/Swiss-Prot;Acc:A4FUI1] |
Percent Identity: | 56.25 % |
Parental protein coverage: | 53.47 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | AHASRDRVIKN-CIAQTSSVVKQLREEREKNLDDLT-LLKQLRKEQTKLKWMQSELNVEE-VVNDRSWKV |
AH..RDRVIK..CI.Q...V.K...EE.E.NLD.LT.L.K...K...KLK.MQSELNVE..V...RS.KV | |
Retrocopy | AHVNRDRVIKM>CISQMLAVLKTSEEEKE-NLDNLT<LVKNSWKRVDKLK*MQSELNVEK>VGEVRS*KV |
Parental | FNERCRIHFK |
.NE...IH.K | |
Retrocopy | YNEPRQIHLK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 15 .64 RPM |
ERP005899_muscle | 0 .00 RPM | 9 .55 RPM |
SRP017611_brain | 0 .00 RPM | 1 .92 RPM |
SRP017611_kidney | 0 .00 RPM | 8 .95 RPM |
SRP017611_liver | 0 .00 RPM | 6 .95 RPM |
SRP030211_testis | 0 .00 RPM | 4 .58 RPM |