RetrogeneDB ID: | retro_btau_986 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 22:11532281..11532526(-) | ||
| Located in intron of: | ENSBTAG00000008567 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA3 | ||
| Ensembl ID: | ENSBTAG00000007754 | ||
| Aliases: | NDUFA3, CI-B9 | ||
| Description: | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 [Source:UniProtKB/Swiss-Prot;Acc:Q02371] |
| Percent Identity: | 52.33 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MAERVAAFLKNVWAKEPVLVASFAIAGLAVILPTLSPYTKYSLMINRAT-PYNYPVPLRDDGNMP-DVPS |
| .AER.AA.L.NV.AKE.VLVASF...G..VILPTLS..TKYS.MIN....P.....P.......P...P. | |
| Retrocopy | LAERIAASLNNVCAKELVLVASFTSGGVPVILPTLSRNTKYSVMINGPSYPRSSQCPSKTMATCP<SYPQ |
| Parental | HPQDPQGPSLEWLKRL |
| .P..P...SLEWLK.L | |
| Retrocopy | DPRGP---SLEWLKKL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 5 .62 RPM |
| ERP005899_muscle | 0 .00 RPM | 47 .93 RPM |
| SRP017611_brain | 0 .00 RPM | 20 .46 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .93 RPM |
| SRP017611_liver | 0 .00 RPM | 11 .40 RPM |
| SRP030211_testis | 0 .01 RPM | 11 .81 RPM |