RetrogeneDB ID: | retro_chof_2005 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
Coordinates: | scaffold_45220:8064..8281(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SVIP | ||
Ensembl ID: | ENSCHOG00000013152 | ||
Aliases: | None | ||
Description: | small VCP/p97-interacting protein [Source:HGNC Symbol;Acc:25238] |
Percent Identity: | 56.16 % |
Parental protein coverage: | 93.51 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MGLCFPCPGEAEPPSPDPEEKRAKLAEAAERRQREAASRGILD-VQSVEEKRKKKEKLEKQIATSGLPPE |
.GLCF.CP.EA.P.....EEKRA.LAEAAE.RQREA.S.GILD.VQSV............Q..TS...PE | |
Retrocopy | VGLCFSCPMEAKPSLLGSEEKRALLAEAAEGRQREATSQGILD>VQSVXXXXXXXXXXXXQVTTSATLPE |
Parental | GGL |
.GL | |
Retrocopy | DGL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000013152 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000016735 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000022838 | 1 retrocopy |