RetrogeneDB ID: | retro_dnov_945 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_125580:4560..4779(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SVIP | ||
| Ensembl ID: | ENSDNOG00000016735 | ||
| Aliases: | None | ||
| Description: | small VCP/p97-interacting protein [Source:HGNC Symbol;Acc:25238] |
| Percent Identity: | 72.6 % |
| Parental protein coverage: | 96.05 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MGLCFPCPGEAEPPSPDPEEKRAKLAEAAERRQREAASRGILNVQSVEEKRKKKERLEKQITTTGPPPEG |
| MGLCFPCPGEAEPPS.DPEEKR.KLAEA.ERRQR.AASRGIL.VQS...............TTTGPPPEG | |
| Retrocopy | MGLCFPCPGEAEPPSADPEEKRTKLAEATERRQR*AASRGILDVQSXXXXXXXXXXXXXXXTTTGPPPEG |
| Parental | GLR |
| GLR | |
| Retrocopy | GLR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 2 .53 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 9 .62 RPM |
| SRP012922_heart | 0 .00 RPM | 6 .03 RPM |
| SRP012922_kidney | 0 .00 RPM | 5 .75 RPM |
| SRP012922_liver | 0 .00 RPM | 2 .63 RPM |
| SRP012922_lung | 0 .00 RPM | 7 .64 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 9 .87 RPM |
| SRP012922_spleen | 0 .00 RPM | 7 .10 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013152 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000016735 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000022838 | 1 retrocopy |