RetrogeneDB ID: | retro_cjac_2799 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 6:31448535..31448710(-) | ||
Located in intron of: | ENSCJAG00000010706 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMA7 | ||
Ensembl ID: | ENSCJAG00000002871 | ||
Aliases: | None | ||
Description: | translation machinery associated 7 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:26932] |
Percent Identity: | 66.15 % |
Parental protein coverage: | 98.44 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | SGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAA-GKGPLATGGIK-KSGKK |
SG..GGKK.PLKQPKKQA..M....K.FK.KQ.EEQKK..ELKAKA...KG.L.TG..K.KSGKK | |
Retrocopy | SGLKGGKKNPLKQPKKQAEKM---NKVFKHKQ-EEQKKHKELKAKAS<RKGALVTGEFK<KSGKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .47 RPM | 11 .36 RPM |
SRP051959_heart | 0 .28 RPM | 11 .17 RPM |
SRP051959_kidney | 0 .22 RPM | 14 .89 RPM |
SRP051959_liver | 0 .30 RPM | 11 .61 RPM |
SRP051959_lung | 0 .36 RPM | 13 .13 RPM |
SRP051959_lymph_node | 0 .37 RPM | 13 .68 RPM |
SRP051959_skeletal_muscle | 0 .28 RPM | 15 .53 RPM |
SRP051959_spleen | 0 .50 RPM | 13 .82 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001193 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000002871 | 18 retrocopies |
retro_cjac_1370, retro_cjac_1449, retro_cjac_1504, retro_cjac_1667, retro_cjac_1670, retro_cjac_1704, retro_cjac_1918, retro_cjac_2092, retro_cjac_2258, retro_cjac_2422, retro_cjac_2629, retro_cjac_2673, retro_cjac_2692, retro_cjac_2799 , retro_cjac_3651, retro_cjac_536, retro_cjac_81, retro_cjac_849,
|
Felis catus | ENSFCAG00000026902 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000028044 | 3 retrocopies | |
Mus musculus | ENSMUSG00000091537 | 11 retrocopies | |
Pan troglodytes | ENSPTRG00000041769 | 9 retrocopies | |
Rattus norvegicus | ENSRNOG00000042689 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000047225 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000011351 | 6 retrocopies |