RetrogeneDB ID: | retro_cjac_3155 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 8:96098210..96098444(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BET1 | ||
Ensembl ID: | ENSCJAG00000013720 | ||
Aliases: | None | ||
Description: | Bet1 golgi vesicular membrane trafficking protein [Source:HGNC Symbol;Acc:14562] |
Percent Identity: | 75.64 % |
Parental protein coverage: | 66.1 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNNLLAEMDSQ |
MRRAGLGE..PPGN.GN.G.ANS.YS.CEEENERL.ESLRSKV.AIKS...EIGH.VKTQN.L.AE.DSQ | |
Retrocopy | MRRAGLGEAGPPGNSGNDG*ANSRYSTCEEENERLAESLRSKVAAIKSFPVEIGHGVKTQNKLSAETDSQ |
Parental | FDSTTGFL |
.DST.G.L | |
Retrocopy | LDSTIGCL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 5 .84 RPM |
SRP051959_heart | 0 .02 RPM | 6 .65 RPM |
SRP051959_kidney | 0 .00 RPM | 16 .35 RPM |
SRP051959_liver | 0 .00 RPM | 9 .92 RPM |
SRP051959_lung | 0 .03 RPM | 8 .41 RPM |
SRP051959_lymph_node | 0 .09 RPM | 6 .32 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 3 .78 RPM |
SRP051959_spleen | 0 .02 RPM | 10 .04 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003424 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001276 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000000895 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000013720 | 3 retrocopies |
retro_cjac_1411, retro_cjac_2019, retro_cjac_3155 ,
|
Dasypus novemcinctus | ENSDNOG00000001012 | 3 retrocopies | |
Homo sapiens | ENSG00000105829 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002176 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000000587 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000007 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015441 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017029 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000004536 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000019408 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000011008 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000015325 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000000765 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000009729 | 2 retrocopies |