RetrogeneDB ID: | retro_opri_249 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
Coordinates: | GeneScaffold_4220:79131..79350(-) | ||
Located in intron of: | ENSOPRG00000014650 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BET1 | ||
Ensembl ID: | ENSOPRG00000004536 | ||
Aliases: | None | ||
Description: | Bet1 golgi vesicular membrane trafficking protein [Source:HGNC Symbol;Acc:14562] |
Percent Identity: | 61.64 % |
Parental protein coverage: | 97.33 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | TVVLSDGVPPGNYGYAGSGYSACEEENERLTESLRSKVSAIKSXXXXXXXXXXXXXXXXXXXDSQFDSTT |
T..L..GVPPGNYGY.GSGYSACEE..ERL.ESLRSKVSAIKS...................DSQFDSTT | |
Retrocopy | TCRLGEGVPPGNYGYTGSGYSACEEDKERLSESLRSKVSAIKSLSVEMDHEVKHQNKLLAEMDSQFDSTT |
Parental | GFL |
G.L | |
Retrocopy | GIL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003424 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001276 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000013720 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000001012 | 3 retrocopies | |
Homo sapiens | ENSG00000105829 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002176 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000000587 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000007 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015441 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017029 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000004536 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000019408 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000011008 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000015325 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000000765 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000009729 | 2 retrocopies |