RetrogeneDB ID: | retro_dnov_393 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_4348:62547..62733(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BET1 | ||
Ensembl ID: | ENSDNOG00000001012 | ||
Aliases: | None | ||
Description: | Bet1 golgi vesicular membrane trafficking protein [Source:HGNC Symbol;Acc:14562] |
Percent Identity: | 71.88 % |
Parental protein coverage: | 51.24 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | NYGYANSGYNACEEE-NERLTESLRNK-VTAIKSLSIEIGHEVKNQNKLLAEMDSQFDSTTGFL |
.Y.YANSGY.AC.EE..ER.T.SLR.K.VTAIKSLSIEI.H..K.QN.LLAE.DSQ.DSTT.FL | |
Retrocopy | HYSYANSGYGACKEE>YERPTQSLRSK<VTAIKSLSIEIDHSIKHQN*LLAEIDSQLDSTTRFL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 8 .75 RPM |
SRP012922_cerebellum | 0 .00 RPM | 5 .36 RPM |
SRP012922_heart | 0 .00 RPM | 4 .87 RPM |
SRP012922_kidney | 0 .00 RPM | 4 .93 RPM |
SRP012922_liver | 0 .00 RPM | 11 .15 RPM |
SRP012922_lung | 0 .00 RPM | 10 .54 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 2 .77 RPM |
SRP012922_spleen | 0 .00 RPM | 17 .05 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003424 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001276 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000013720 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000001012 | 3 retrocopies |
retro_dnov_1683, retro_dnov_393 , retro_dnov_60,
|
Homo sapiens | ENSG00000105829 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002176 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000000587 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000007 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015441 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017029 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000004536 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000019408 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000011008 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000015325 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000000765 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000009729 | 2 retrocopies |