RetrogeneDB ID: | retro_tsyr_1843 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_617458:306..495(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BET1 | ||
| Ensembl ID: | ENSTSYG00000009729 | ||
| Aliases: | None | ||
| Description: | Bet1 golgi vesicular membrane trafficking protein [Source:HGNC Symbol;Acc:14562] |
| Percent Identity: | 63.49 % |
| Parental protein coverage: | 80.77 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | GSHGYTGSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKSQNKLLTEMDSQFDSTTGFL |
| G..G....G...CE.EN.RLT..LRSK.T.IKSLSIEIGHE.K..N.LL...DS.FDSTTGFL | |
| Retrocopy | GNYGCANRGICTCEQENQRLTARLRSKGTTIKSLSIEIGHEAKNKNELLVGVDS*FDSTTGFL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003424 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001276 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013720 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000001012 | 3 retrocopies | |
| Homo sapiens | ENSG00000105829 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002176 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000587 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000007 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015441 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017029 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000004536 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000019408 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011008 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000015325 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000000765 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009729 | 2 retrocopies |
retro_tsyr_136, retro_tsyr_1843 ,
|