RetrogeneDB ID: | retro_cjac_338 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 4:5838620..5839130(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCJAG00000034032 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HDGF | ||
Ensembl ID: | ENSCJAG00000006157 | ||
Aliases: | None | ||
Description: | hepatoma-derived growth factor [Source:HGNC Symbol;Acc:4856] |
Percent Identity: | 64.23 % |
Parental protein coverage: | 53.52 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | NKYQVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCVEEP |
N.YQVFFFGTHETAFL.PK.LFPY.ESKEKFGKPNKR.GF.EGLWEIENNPTV.AS.............P | |
Retrocopy | NRYQVFFFGTHETAFLSPKRLFPYKESKEKFGKPNKRRGFREGLWEIENNPTVQASDCVFAPEMGGGDGP |
Parental | EPEPEATEGDSDKKGNAEGSSDEEGKLVIDEPAKEKNEKGALKRRAGDLLEDSPKRPKEAENPEEEE |
.PEPEA.E.D.DK...AEG..DE......DEPA.E..EKG.LKR.AGD...D.PKRPK.A....EEE | |
Retrocopy | RPEPEAAESDADKPNHAEGGGDEPRMPDDDEPAEE--EKGPLKRSAGDPPDDAPKRPKKADPDQEEE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 60 .46 RPM |
SRP051959_heart | 0 .00 RPM | 26 .87 RPM |
SRP051959_kidney | 0 .00 RPM | 60 .72 RPM |
SRP051959_liver | 0 .00 RPM | 42 .84 RPM |
SRP051959_lung | 0 .00 RPM | 29 .12 RPM |
SRP051959_lymph_node | 0 .00 RPM | 21 .30 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 41 .54 RPM |
SRP051959_spleen | 0 .00 RPM | 26 .95 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_33 |
Pan troglodytes | retro_ptro_1 |
Pongo abelii | retro_pabe_6 |
Bos taurus | retro_btau_216 |
Sus scrofa | retro_sscr_65 |
Equus caballus | retro_ecab_5 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000039793 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000006157 | 2 retrocopies |
retro_cjac_338 , retro_cjac_4022,
|
Callithrix jacchus | ENSCJAG00000012471 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000015775 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000010231 | 1 retrocopy | |
Equus caballus | ENSECAG00000011178 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000005243 | 1 retrocopy | |
Homo sapiens | ENSG00000143321 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000010413 | 1 retrocopy | |
Mus musculus | ENSMUSG00000004897 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000703 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001474 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000006468 | 1 retrocopy |