RetrogeneDB ID: | retro_cpor_1054 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_41:8920580..8920994(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NUDT21 | ||
| Ensembl ID: | ENSCPOG00000003705 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.54 % |
| Parental protein coverage: | 60.79 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | QTGWPRGVNQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRT |
| Q..W..GVNQFGNKYIQQTKPLTLE.TI.LY.LTNY.FG.K.PL.EKDSSVAA.F..MREEFDKIG.R.. | |
| Retrocopy | QMDWLQGVNQFGNKYIQQTKPLTLEHTIYLYSLTNYPFGMKVPLNEKDSSVAANFLCMREEFDKIGLRKI |
| Parental | VEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGN |
| ...VLIV.EH.LPH..LLQLGTTFFKLPG.ELNPG.DEVEGLK.LMTEIL.RQDGVL.DWVID.C.GN | |
| Retrocopy | IKQVLIVLEHQLPHM*LLQLGTTFFKLPGCELNPGKDEVEGLKHLMTEILSRQDGVLPDWVIDYCTGN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 19 .56 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .88 RPM |
| SRP017611_liver | 0 .00 RPM | 15 .41 RPM |
| SRP040447_lung | 0 .00 RPM | 18 .89 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 11 .35 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000012724 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000003705 | 1 retrocopy |
retro_cpor_1054 ,
|
| Felis catus | ENSFCAG00000008669 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000028465 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000003451 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031754 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017224 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000014888 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000006689 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000009651 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029848 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000013545 | 1 retrocopy |