RetrogeneDB ID: | retro_cpor_1204 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_56:11485642..11486083(+) | ||
| Located in intron of: | ENSCPOG00000010325 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PSME3 | ||
| Ensembl ID: | ENSCPOG00000012552 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.39 % |
| Parental protein coverage: | 57.87 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLD |
| .L.SNQ.LV..IE.VKPEI.LL.EKCNTV.MWVQLLIP..EDGNNFGVSIQE.TV..L.TVES.A.SYL. | |
| Retrocopy | LLRSNQHLVELIERVKPEIELLREKCNTVRMWVQLLIPKVEDGNNFGVSIQEDTVDQLWTVESTATSYLR |
| Parental | QISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS |
| ..S.YY.TRAKLVSK..KYP.VEDY.RT..E.DE.EY.S.R.I....RNQY.TLHD.ILKN.EKIK.PRS | |
| Retrocopy | RFSTYYNTRAKLVSKLVKYPQVEDYLRTIAEVDENEYLSVRQILVHVRNQYATLHDVILKNMEKIKTPRS |
| Parental | SNAETLY |
| .N...LY | |
| Retrocopy | TNTDNLY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .12 RPM | 48 .08 RPM |
| SRP017611_kidney | 0 .52 RPM | 44 .49 RPM |
| SRP017611_liver | 0 .00 RPM | 31 .60 RPM |
| SRP040447_lung | 0 .23 RPM | 45 .93 RPM |
| SRP040447_skeletal_muscle | 0 .08 RPM | 40 .09 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000013688 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000019918 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013111 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012552 | 1 retrocopy |
retro_cpor_1204 ,
|
| Equus caballus | ENSECAG00000012620 | 2 retrocopies | |
| Homo sapiens | ENSG00000131467 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000013446 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010027 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000015986 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000008372 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000009225 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000017385 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000028833 | 1 retrocopy |