RetrogeneDB ID: | retro_cjac_2307 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 4:2432981..2433379(+) | ||
| Located in intron of: | ENSCJAG00000010877 | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000010934 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PSME3 | ||
| Ensembl ID: | ENSCJAG00000013111 | ||
| Aliases: | None | ||
| Description: | proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) [Source:HGNC Symbol;Acc:9570] |
| Percent Identity: | 85.93 % |
| Parental protein coverage: | 50.19 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPI |
| MASLLKVDQEVKLKVDSFRE.IT.EA.DL.ANFF.KKLLEL.SFLKEPILNIHD..QIHSDM.LPVPDPI | |
| Retrocopy | MASLLKVDQEVKLKVDSFREQITREA-DLMANFFTKKLLELYSFLKEPILNIHDQAQIHSDMSLPVPDPI |
| Parental | LLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIR-LLIEKCN |
| LLTNSHDGL.G.TYKKRRLDECEEAFQG.KVFV.PNG.L.SNQQLV..IEKVKPEIR.LL.EKCN | |
| Retrocopy | LLTNSHDGLYGRTYKKRRLDECEEAFQGIKVFVVPNGTLQSNQQLVHVIEKVKPEIR<LLTEKCN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 17 .42 RPM |
| SRP051959_heart | 0 .07 RPM | 12 .26 RPM |
| SRP051959_kidney | 0 .00 RPM | 17 .99 RPM |
| SRP051959_liver | 0 .00 RPM | 10 .87 RPM |
| SRP051959_lung | 0 .03 RPM | 12 .30 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 14 .98 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 18 .02 RPM |
| SRP051959_spleen | 0 .00 RPM | 14 .22 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000013688 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000019918 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007167 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013111 | 1 retrocopy |
retro_cjac_2307 ,
|
| Cavia porcellus | ENSCPOG00000012552 | 1 retrocopy | |
| Equus caballus | ENSECAG00000012620 | 2 retrocopies | |
| Homo sapiens | ENSG00000131467 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000013446 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010027 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000015986 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000008372 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000009225 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000017385 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000028833 | 1 retrocopy |