RetrogeneDB ID: | retro_cpor_1336 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_7:33338182..33338590(-) | ||
Located in intron of: | ENSCPOG00000012495 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ANP32B | ||
Ensembl ID: | ENSCPOG00000020118 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 57.45 % |
Parental protein coverage: | 81.66 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | ELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVCLLSVSNLPKLPKL-KKLELSDNRIFGGLDMLAEKLPN |
.L.LDNCKSN.G..EGL.AE..NLE.L.LI.V.L.S.S.L..LPK...K....D..I..GLDMLAEKLP. | |
Retrocopy | KLALDNCKSNEGAAEGLAAEPLNLEVLHLISVRLISISVLHQLPKV<RKRKHHDSKIIRGLDMLAEKLPK |
Parental | LTHLNLSGNKLKD-ISTLEPLKKLDCLKSLDLFNCEVTNLNDYRESVFKLLPQLSYLDGYDREDR-EAPD |
L.H.NLSG.KLK...STL.PL.K.DC.K.......EV..LNDY.E.V.K...QLS.LDG..RED...APD | |
Retrocopy | LIHPNLSGDKLKS<TSTLAPLNKVDCQKAGSV-SREVNTLNDYQETVLKVAAQLSELDGQCREDH<QAPD |
Parental | S |
S | |
Retrocopy | S |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .06 RPM | 18 .52 RPM |
SRP017611_kidney | 0 .00 RPM | 40 .51 RPM |
SRP017611_liver | 0 .04 RPM | 22 .81 RPM |
SRP040447_lung | 0 .05 RPM | 37 .48 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 20 .37 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000005149 | 6 retrocopies | |
Cavia porcellus | ENSCPOG00000020118 | 3 retrocopies |
retro_cpor_1336 , retro_cpor_493, retro_cpor_509,
|
Equus caballus | ENSECAG00000012310 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000015514 | 4 retrocopies | |
Homo sapiens | ENSG00000136938 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000004844 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000012242 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000003261 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000006433 | 1 retrocopy | |
Mus musculus | ENSMUSG00000028333 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016941 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000006091 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000019430 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000021172 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000006569 | 1 retrocopy | |
Sorex araneus | ENSSARG00000000804 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000002189 | 8 retrocopies | |
Tursiops truncatus | ENSTTRG00000010825 | 2 retrocopies |