RetrogeneDB ID: | retro_cpor_143 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_0:82704227..82704616(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PDZD11 | ||
Ensembl ID: | ENSCPOG00000000210 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72.52 % |
Parental protein coverage: | 92.14 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | PVVFLPAYENP-PAWIPPHERLYHPDYNNELTQFLPRIVTLKKPPGAQLGFNIRGGKASQLGIFISKVIP |
P.VFL.AYEN....W.PPHER...PDYN..LT.FLP...TLK.PPGAQLGFNI.GG.ASQL..FISKVIP | |
Retrocopy | PYVFLLAYENS>SIWSPPHERVDQPDYNHVLT*FLPQTITLKEPPGAQLGFNIGGGNASQLVVFISKVIP |
Parental | DSDAHRAGLQEGDQVLAV-NDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTV |
DSD.H.AGLQEG.QVLAV.NDVD.QDIEHSK.V..LKTA.EIS....FF.YNYH.QKERTV | |
Retrocopy | DSDTHPAGLQEG*QVLAV>NDVDCQDIEHSKPVGVLKTACEISIWLHFFYYNYHHQKERTV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 13 .34 RPM |
SRP017611_kidney | 0 .10 RPM | 12 .14 RPM |
SRP017611_liver | 0 .00 RPM | 8 .84 RPM |
SRP040447_lung | 0 .00 RPM | 12 .53 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 4 .76 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009203 | 1 retrocopy | |
Bos taurus | ENSBTAG00000012860 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000012432 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000000210 | 1 retrocopy |
retro_cpor_143 ,
|
Echinops telfairi | ENSETEG00000008626 | 3 retrocopies | |
Felis catus | ENSFCAG00000008633 | 3 retrocopies | |
Homo sapiens | ENSG00000120509 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006626 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000012040 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000013938 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000863 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017101 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000001811 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000020929 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021995 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000002838 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000005380 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000027107 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000007864 | 1 retrocopy |