RetrogeneDB ID: | retro_ocun_1208 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 3:114823430..114823783(-) | ||
Located in intron of: | ENSOCUG00000008725 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PDZD11 | ||
Ensembl ID: | ENSOCUG00000017101 | ||
Aliases: | None | ||
Description: | PDZ domain containing 11 [Source:HGNC Symbol;Acc:28034] |
Percent Identity: | 79.83 % |
Parental protein coverage: | 83.57 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MDSRIPYDDYPVVFLPAYENPPAWIPPHERV-YHPDYNNELTQFLPRVVTLKKPPG-AQLGFNIRGGKAS |
MDSRIPY.DY.VVFL...ENPPA.IPPHE.V.YHPD.NN.LTQ.L...VTLKKPPG.AQLGFNIRGGKAS | |
Retrocopy | MDSRIPYNDYTVVFLTPHENPPA*IPPHETV>YHPDNNNRLTQCLTQIVTLKKPPG>AQLGFNIRGGKAS |
Parental | QLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTA |
QLGIF..KVIPDSDAH..G.QEGDQVLA.ND.DF.D.EHSKAVEILKTA | |
Retrocopy | QLGIFNCKVIPDSDAHQEGCQEGDQVLAINDEDF*DTEHSKAVEILKTA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 37 .58 RPM |
SRP017611_kidney | 0 .00 RPM | 38 .92 RPM |
SRP017611_liver | 0 .00 RPM | 8 .94 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009203 | 1 retrocopy | |
Bos taurus | ENSBTAG00000012860 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000012432 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000000210 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000008626 | 3 retrocopies | |
Felis catus | ENSFCAG00000008633 | 3 retrocopies | |
Homo sapiens | ENSG00000120509 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006626 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000012040 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000013938 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000863 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017101 | 2 retrocopies |
retro_ocun_1208 , retro_ocun_1945,
|
Ochotona princeps | ENSOPRG00000001811 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000020929 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021995 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000002838 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000005380 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000027107 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000007864 | 1 retrocopy |