RetrogeneDB ID: | retro_cpor_216 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_10:18867998..18868355(-) | ||
| Located in intron of: | ENSCPOG00000007938 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRI | ||
| Ensembl ID: | ENSCPOG00000010096 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 54.4 % |
| Parental protein coverage: | 60.61 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 5 |
| Parental | GAGGGYYPGGFGGAPG-GPAFPAQTQDPQYGYFA-AVAGQDGQIDADELQRCLTQ-SGIAGGYKPFNL-E |
| G..G...P.G.GG.P...P.F..Q.QD....YF...VAG..G..D..ELQ.CL...SGIAG..K.FNL.E | |
| Retrocopy | GHCGRCCPDGCGGTPE<DPVFLGQPQDLLCRYFV<LVAGEAGYKDTKELQNCLKI>SGIAGE*KAFNL<E |
| Parental | TCRLMVSMLDKDMSGTMGFTEFKELWSV-LNGWKQHFTSFDSDRSGTVDPQELHK |
| TC...VS.LDKD.SGTM.F.EFKELW....NGWKQ.F..F.S..SGT.DPQE... | |
| Retrocopy | TCPFTVSTLDKDVSGTMQFKEFKELWDI<MNGWKQYFICFGSESSGTMDPQEFQE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .46 RPM | 38 .42 RPM |
| SRP017611_kidney | 0 .52 RPM | 73 .07 RPM |
| SRP017611_liver | 0 .17 RPM | 45 .62 RPM |
| SRP040447_lung | 0 .38 RPM | 64 .92 RPM |
| SRP040447_skeletal_muscle | 0 .03 RPM | 16 .09 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000001855 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000010096 | 1 retrocopy |
retro_cpor_216 ,
|
| Latimeria chalumnae | ENSLACG00000000210 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000027380 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000010355 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000018313 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000007438 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000049780 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000004372 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000004434 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014640 | 1 retrocopy | |
| Xenopus tropicalis | ENSXETG00000008793 | 1 retrocopy |