RetrogeneDB ID: | retro_cpor_462 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_16:1619570..1619798(-) | ||
| Located in intron of: | ENSCPOG00000013113 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRP14 | ||
| Ensembl ID: | ENSCPOG00000008994 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.83 % |
| Parental protein coverage: | 70.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | DGRTRSIPKKGTVEGFEPSDNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKN |
| DG.TRSIP.KG.VEGFEP.DN.CLLRAT.G.K..STVVSSK...KFQM.YS.LLRANMD.LKK..KKN.. | |
| Retrocopy | DGQTRSIPNKGSVEGFEPLDNMCLLRATHGEK-VSTVVSSKDMSKFQMVYSDLLRANMDRLKKKGKKNNK |
| Parental | KKAKTAQ |
| .....AQ | |
| Retrocopy | DQISIAQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 27 .21 RPM |
| SRP017611_kidney | 0 .00 RPM | 27 .74 RPM |
| SRP017611_liver | 0 .00 RPM | 18 .32 RPM |
| SRP040447_lung | 0 .00 RPM | 25 .70 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 28 .52 RPM |