RetrogeneDB ID: | retro_cpor_508 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_175:1280514..1280886(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FUNDC1 | ||
Ensembl ID: | ENSCPOG00000012962 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 63.28 % |
Parental protein coverage: | 81.29 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | RRHHWWNRVFGHRSG-PMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQ |
RR..WWNRVF...S..PMVE.YS.ATQI...G.TG.CA.FLFQKV.KLAA..VGGGFL.LQ.AS.S.Y.. | |
Retrocopy | RRYPWWNRVFSNQSH<PMVEIYSAATQILTDGMTGCCAEFLFQKVRKLAA-MVGGGFLPLQTASLSSYF* |
Parental | IDWKRVEKDVNKAKRQ-IKKRANKAAPEINNVIEEATEFIKQNIVISSGFVGGFLLGL |
I.W....K.....KRQ.I.K.ANKA..EINNVI...TEFIKQN.V..SGFVGGF.L.L | |
Retrocopy | IKWES-*KRCKQRKRQ>I*KPANKAVTEINNVIKKLTEFIKQNTVLTSGFVGGFCLAL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 8 .28 RPM |
SRP017611_kidney | 0 .00 RPM | 7 .96 RPM |
SRP017611_liver | 0 .00 RPM | 4 .35 RPM |
SRP040447_lung | 0 .05 RPM | 6 .08 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 6 .18 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000010876 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012962 | 2 retrocopies |
retro_cpor_507, retro_cpor_508 ,
|
Echinops telfairi | ENSETEG00000012763 | 3 retrocopies | |
Homo sapiens | ENSG00000069509 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000023311 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000010215 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000006795 | 5 retrocopies | |
Microcebus murinus | ENSMICG00000000450 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000003505 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000021088 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000002513 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000029753 | 5 retrocopies | |
Pongo abelii | ENSPPYG00000020268 | 2 retrocopies | |
Pelodiscus sinensis | ENSPSIG00000013793 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021821 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000003470 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000000501 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000009139 | 1 retrocopy |