RetrogeneDB ID: | retro_rnor_2644 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 8:102863417..102863821(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Fundc1 | ||
Ensembl ID: | ENSRNOG00000003470 | ||
Aliases: | None | ||
Description: | FUN14 domain-containing protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q5BJS4] |
Percent Identity: | 60.42 % |
Parental protein coverage: | 89.03 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 6 |
Parental | ESDDESYEV-LDLTEYAR-RHHWWNRVF-GHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATA |
ES.D.S.E..LDL.EYAR.RHH.W..V..GHSSG..VE.Y.VA.Q.V.G..T..CAG..FQK..KLA..A | |
Retrocopy | ESNDQS*EG<LDLAEYAR<RHHQWQ*VL<GHSSGAKVERYPVAPQVVRGNKTLRCAGI*FQKDRKLA--A |
Parental | VG-GGFLLLQVASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNIIEE-ATDFI-KQNIVISSGF |
.G.GG.LLLQV.SH.G.VQ..WKRVEK..NKAKRQIK.R..KA..EIN.IIEE..T.FI..Q...IS... | |
Retrocopy | TG>GGGLLLQVSSHGGFVQTNWKRVEKGINKAKRQIKERSKKAVTEINIIIEE<TTKFI<QQDVEISIDL |
Parental | VGGF |
.GGF | |
Retrocopy | MGGF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .14 RPM | 19 .27 RPM |
SRP017611_kidney | 0 .00 RPM | 16 .89 RPM |
SRP017611_liver | 0 .00 RPM | 6 .05 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000010876 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012962 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000012763 | 3 retrocopies | |
Homo sapiens | ENSG00000069509 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000023311 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000010215 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000006795 | 5 retrocopies | |
Microcebus murinus | ENSMICG00000000450 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000003505 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000021088 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000002513 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000029753 | 5 retrocopies | |
Pongo abelii | ENSPPYG00000020268 | 2 retrocopies | |
Pelodiscus sinensis | ENSPSIG00000013793 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021821 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000003470 | 1 retrocopy |
retro_rnor_2644 ,
|
Rattus norvegicus | ENSRNOG00000024066 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000000501 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000009139 | 1 retrocopy |