RetrogeneDB ID: | retro_cpor_865 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_30:4437962..4438277(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATG12 | ||
| Ensembl ID: | ENSCPOG00000007187 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.22 % |
| Parental protein coverage: | 60.47 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | PSAVAAGGEGLGELSPETATPEP-PSAAVSPGTEEPAGDTKKKIDVLLKAVGDTPIMKTKKWAVERTRTI |
| P.AVAAG...LGELS.ETATP.P..SAAV..G.E.PA.DTKK.ID...KAVGDTPI.K..KWAVE...TI | |
| Retrocopy | PVAVAAGSRALGELSLETATP*PHSSAAVLSGKEGPASDTKKRIDIWVKAVGDTPIRKANKWAVEQMLTI |
| Parental | QGLIDFIKKFL-KLVASEQLFIYVNQSFAPS-PDQEV |
| .GLI....K.L.K.VASEQLFIYV.QSFA.S.PDQEV | |
| Retrocopy | *GLIXXXXKVL>KFVASEQLFIYVTQSFALS<PDQEV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 13 .57 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .77 RPM |
| SRP017611_liver | 0 .00 RPM | 19 .28 RPM |
| SRP040447_lung | 0 .00 RPM | 13 .67 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 9 .60 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004464 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000007187 | 2 retrocopies |
retro_cpor_865 , retro_cpor_944,
|
| Equus caballus | ENSECAG00000012452 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000018837 | 1 retrocopy | |
| Homo sapiens | ENSG00000145782 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016888 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000015307 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002759 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015699 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000017154 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000000157 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011755 | 1 retrocopy |