RetrogeneDB ID: | retro_ggor_1814 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 2b:111889670..111890076(-) | ||
Located in intron of: | ENSGGOG00000002675 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATG12 | ||
Ensembl ID: | ENSGGOG00000016888 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 53.52 % |
Parental protein coverage: | 73.66 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 3 |
Parental | EESQSVLQLPPSSAAGGEGLT-DVSPETTTPEPPSSAAVSPGTEEPAGDTKK-KIDILLKAVGDTPIMKT |
.......QLPP..AAG..GLT..VSP.......P......PGT..PAG..KK.K.DILLKAVG..PIM.T | |
Retrocopy | QKLKTMSQLPPLTAAGSKGLTLEVSPKQAL-QTPLIPL*FPGTQDPAGNIKK<KSDILLKAVGHVPIMQT |
Parental | KKWAVERTRTIQGLIDFI-KKFLKLVASEQLFIYVNQS-FAPSPDQEVGTLYECF-GSDGKLVLHYCKSQ |
KK.AV..TRTIQ.L.DFI.KKFLKL..S.....Y...S.F...P......L...F..SDGKLVLHYCKSQ | |
Retrocopy | KKQAVK*TRTIQRLLDFI>KKFLKLATS---VVYLCESGFCSFPGPGIWNLL*AF>SSDGKLVLHYCKSQ |
Parental | AW |
AW | |
Retrocopy | AW |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 5 .61 RPM |
SRP007412_cerebellum | 0 .00 RPM | 4 .92 RPM |
SRP007412_heart | 0 .00 RPM | 1 .25 RPM |
SRP007412_kidney | 0 .04 RPM | 4 .70 RPM |
SRP007412_liver | 0 .03 RPM | 5 .35 RPM |
SRP007412_testis | 0 .10 RPM | 12 .64 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_1748 |
Pongo abelii | retro_pabe_2158 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000004464 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000007187 | 2 retrocopies | |
Equus caballus | ENSECAG00000012452 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000018837 | 1 retrocopy | |
Homo sapiens | ENSG00000145782 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016888 | 2 retrocopies |
retro_ggor_1814 , retro_ggor_2150,
|
Loxodonta africana | ENSLAFG00000015307 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000002759 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015699 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000017154 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000000157 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000011755 | 1 retrocopy |