RetrogeneDB ID: | retro_dnov_1040 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_140123:1063..1465(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GEMIN2 | ||
Ensembl ID: | ENSDNOG00000018278 | ||
Aliases: | None | ||
Description: | gem (nuclear organelle) associated protein 2 [Source:HGNC Symbol;Acc:10884] |
Percent Identity: | 74.64 % |
Parental protein coverage: | 63.98 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 3 |
Parental | KRRQTVNVSLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQSMNKHRSHWKSQQLDSNVTMPKSEDEEGWK- |
K.RQTVNVSL.GCQPAP.GYS..LQ.QQQQVA.FSTV.QS.NKHR...K.QQLDSN.TMPKSE.EEGWK. | |
Retrocopy | K*RQTVNVSL*GCQPAPKGYSLILQKQQQQVARFSTV*QSVNKHRRPQKPQQLDSNMTMPKSEHEEGWK< |
Parental | KFCLGERLCAEGAPGPATNENPGIDYVQI-GFPPLLSI-VSRMNQATVTSVLEYLSNWFGERDFTPEL |
.FCLGERLCA.G..GPAT.ENP.ID.V....F.PLL....SR.NQA.VTS.LEYLSNWFGERDFTPEL | |
Retrocopy | NFCLGERLCAGGTAGPATSENPEIDCV*V<DFLPLLRL<ISRKNQAIVTSILEYLSNWFGERDFTPEL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 7 .39 RPM |
SRP012922_cerebellum | 0 .00 RPM | 19 .93 RPM |
SRP012922_heart | 0 .00 RPM | 7 .89 RPM |
SRP012922_kidney | 0 .00 RPM | 5 .48 RPM |
SRP012922_liver | 0 .00 RPM | 4 .49 RPM |
SRP012922_lung | 0 .15 RPM | 9 .01 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 5 .37 RPM |
SRP012922_spleen | 0 .00 RPM | 12 .82 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000016248 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000018278 | 1 retrocopy |
retro_dnov_1040 ,
|
Homo sapiens | ENSG00000092208 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016691 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000004811 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000002619 | 1 retrocopy | |
Mus musculus | ENSMUSG00000060121 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005764 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000006291 | 1 retrocopy |