RetrogeneDB ID: | retro_dnov_115 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_173:152..499(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000011544 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 82.05 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MGTLPERKDIPPWVKVPEDLRDPEVFQVQTRLLEAMFGPQGSRIPYIEQVSKAMLELKVLESSDLTEVVV |
MGT.PE.KDIPPWVKVPEDL.DP.VFQVQ..LLEAMFGP.GSRIPYIEQVSK.MLELK..ESSDLT.VVV | |
Retrocopy | MGTFPE*KDIPPWVKVPEDLKDPKVFQVQMWLLEAMFGPYGSRIPYIEQVSKTMLELKIRESSDLTKVVV |
Parental | YGNYLYKLRTKWMLQSLAEWHRQRQEREMLRLE-EAMNALELGPWTQ |
YGNYLYKL.TKWMLQSLAE.H.QRQE....RLE.EAMNALELGPW.. | |
Retrocopy | YGNYLYKLWTKWMLQSLAERHCQRQEQGVPRLE<EAMNALELGPWVE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 0 .00 RPM |
SRP012922_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP012922_heart | 0 .00 RPM | 0 .00 RPM |
SRP012922_kidney | 0 .00 RPM | 0 .00 RPM |
SRP012922_liver | 0 .00 RPM | 0 .00 RPM |
SRP012922_lung | 0 .00 RPM | 0 .00 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 0 .00 RPM |
SRP012922_spleen | 0 .11 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002647 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000012338 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009945 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000011544 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000000378 | 2 retrocopies | |
Homo sapiens | ENSG00000203909 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012001 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000018513 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004463 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000417 | 1 retrocopy | |
Mus musculus | ENSMUSG00000060461 | 7 retrocopies | |
Pongo abelii | ENSPPYG00000016771 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000029547 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000199 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000004283 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000005326 | 2 retrocopies |