RetrogeneDB ID: | retro_mmus_2557 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 5:29538152..29538506(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000078182 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Dppa5a | ||
Ensembl ID: | ENSMUSG00000060461 | ||
Aliases: | Dppa5a, AA536857, Dppa5, Esg1, ecat2 | ||
Description: | developmental pluripotency associated 5A [Source:MGI Symbol;Acc:MGI:101800] |
Percent Identity: | 94.07 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MMVTLVTRKDIPPWVKVPEDLKDPEVFQVQSLVLKYLFGPQGSRMSHIEQVSQAMFELKNLESPEELIEV |
MMVTL.TRKDIPPWVKVPEDLKDPEVFQVQSLVLK.LFGPQGSRMSHIEQVSQAMFELKNLESPEELIEV | |
Retrocopy | MMVTLMTRKDIPPWVKVPEDLKDPEVFQVQSLVLKSLFGPQGSRMSHIEQVSQAMFELKNLESPEELIEV |
Parental | FIYGSQNNKIRAKWMLQSMAERYHLRQQKGVLKLEESMKTLELGQCIE |
F.YGSQNNK..AKW.LQSMAERY.LRQQKGVLKLEESMKTLELGQCIE | |
Retrocopy | FLYGSQNNKVLAKWILQSMAERYRLRQQKGVLKLEESMKTLELGQCIE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .02 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .04 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .02 RPM | 0 .02 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .05 RPM | 0 .09 RPM |
TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
---|---|---|---|---|---|---|
no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
TSS #1 | TSS_113076 | 1037 libraries | 5 libraries | 14 libraries | 14 libraries | 2 libraries |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002647 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000012338 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009945 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000011544 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000000378 | 2 retrocopies | |
Homo sapiens | ENSG00000203909 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012001 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004463 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000417 | 1 retrocopy | |
Mus musculus | ENSMUSG00000060461 | 7 retrocopies |
retro_mmus_127, retro_mmus_1280, retro_mmus_1537, retro_mmus_1666, retro_mmus_2557 , retro_mmus_3415, retro_mmus_58,
|
Pongo abelii | ENSPPYG00000016771 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000029547 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000199 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000004283 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000005326 | 2 retrocopies |