RetrogeneDB ID: | retro_mmus_1280 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 14:54805745..54806045(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Dppa5a | ||
Ensembl ID: | ENSMUSG00000060461 | ||
Aliases: | Dppa5a, AA536857, Dppa5, Esg1, ecat2 | ||
Description: | developmental pluripotency associated 5A [Source:MGI Symbol;Acc:MGI:101800] |
Percent Identity: | 74.29 % |
Parental protein coverage: | 88.98 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | WVKVPEDLKDPEVFQVQSLVLKYLFGPQGSRMSHIEQVSQAMFELKNLESPEELIEVFIYGSQNNKIRAK |
W.KVP.DLKDPEVFQVQSLVLK.LFGPQGS.M....QVSQA.FELKNLES..EL....IYGSQN.K.RA. | |
Retrocopy | WMKVP*DLKDPEVFQVQSLVLKSLFGPQGS*M----QVSQAVFELKNLESS*ELTKLLIYGSQN-KLRAE |
Parental | WMLQSMAERYHLRQQKGVLKLEESMKTLELGQCIE |
WMLQSMAER..LRQQ...L.LEE..KTLELGQC.E | |
Retrocopy | WMLQSMAERCCLRQQRRMLTLEETVKTLELGQCTE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .02 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .04 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .02 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .05 RPM | 0 .09 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002647 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000012338 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009945 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000011544 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000000378 | 2 retrocopies | |
Homo sapiens | ENSG00000203909 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012001 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004463 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000417 | 1 retrocopy | |
Mus musculus | ENSMUSG00000060461 | 7 retrocopies |
retro_mmus_127, retro_mmus_1280 , retro_mmus_1537, retro_mmus_1666, retro_mmus_2557, retro_mmus_3415, retro_mmus_58,
|
Pongo abelii | ENSPPYG00000016771 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000029547 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000199 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000004283 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000005326 | 2 retrocopies |