RetrogeneDB ID: | retro_dnov_1572 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_23739:39460..39889(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000008670 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.07 % |
| Parental protein coverage: | 51.06 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
| Parental | TTAVKIGIIGGTGLDDPDILEGRTEKYVDTPFGKPSDALILGK-IKNVDCVLLARHGRQHTIMPSKVNYQ |
| TTAV.IGIIGGTGL.DP.ILEGR.EKYVDTPFGKP..A...G..IKNV.CVLLA..GR.H.I..SKVN.Q | |
| Retrocopy | TTAVQIGIIGGTGLNDPEILEGRAEKYVDTPFGKPTNAFV*GR<IKNVGCVLLAKLGR*HIIVASKVN*Q |
| Parental | ANIWALKEEGCS-HVIVTTACGSLREEIQPGDIVIIDQFIDRTTVRPQTFYDG-SHSCTRGVCHIPMAEP |
| .NIW.LKEEGC...VIVTTACGSLREE.QP..IVIIDQF.DR.T..P..FYD..S.S.TRGV...PM.E. | |
| Retrocopy | VNIWPLKEEGCT<CVIVTTACGSLREEVQPSNIVIIDQFMDRATTKPKPFYDE<SRSWTRGVGRVPMVES |
| Parental | FCPKTRE |
| .CPKT.E | |
| Retrocopy | LCPKTSE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 4 .67 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 3 .02 RPM |
| SRP012922_heart | 0 .00 RPM | 3 .25 RPM |
| SRP012922_kidney | 0 .00 RPM | 2 .46 RPM |
| SRP012922_liver | 0 .00 RPM | 1 .70 RPM |
| SRP012922_lung | 0 .00 RPM | 2 .75 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 7 .96 RPM |
| SRP012922_spleen | 0 .00 RPM | 5 .27 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000025929 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000002224 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000008021 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000000825 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008670 | 1 retrocopy |
retro_dnov_1572 ,
|
| Echinops telfairi | ENSETEG00000013214 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000015381 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000015072 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001137 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000013963 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000012289 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000007889 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000001259 | 1 retrocopy |