RetrogeneDB ID: | retro_oana_38 | ||
Retrocopylocation | Organism: | Platypus (Ornithorhynchus anatinus) | |
Coordinates: | Contig167268:323..587(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSOANG00000013963 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 69.23 % |
Parental protein coverage: | 77.78 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | LEGRTEKIVETPYGKPSDALILGKIKNVDCVLLARHGRQHTIMPSAVNFQANIWALKEEGCTHIIVTTAC |
....T...V...Y.K....L.........C....RHGRQHTIMPSAVNFQANIWALKEEGCTHIIVTTAC | |
Retrocopy | MDHTTQSLVLSFYSKQLKCLCVXXXXXLFC---HRHGRQHTIMPSAVNFQANIWALKEEGCTHIIVTTAC |
Parental | GSLREEIQPGDIVLIDQFIDR |
GSLREEIQPGDIVLIDQFIDR | |
Retrocopy | GSLREEIQPGDIVLIDQFIDR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 6 .01 RPM |
SRP007412_cerebellum | 0 .00 RPM | 3 .42 RPM |
SRP007412_heart | 0 .00 RPM | 10 .45 RPM |
SRP007412_kidney | 0 .00 RPM | 18 .06 RPM |
SRP007412_liver | 0 .00 RPM | 13 .74 RPM |
SRP007412_testis | 0 .00 RPM | 13 .64 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000025929 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000002224 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000008021 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000000825 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000008670 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000013214 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000015381 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000015072 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000001137 | 1 retrocopy | |
Ornithorhynchus anatinus | ENSOANG00000013963 | 1 retrocopy |
retro_oana_38 ,
|
Oryctolagus cuniculus | ENSOCUG00000012289 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000007889 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000001259 | 1 retrocopy |