RetrogeneDB ID: | retro_dnov_1885 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_34993:13736..14023(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BLOC1S6 | ||
| Ensembl ID: | ENSDNOG00000019785 | ||
| Aliases: | None | ||
| Description: | biogenesis of lysosomal organelles complex-1, subunit 6, pallidin [Source:HGNC Symbol;Acc:8549] |
| Percent Identity: | 61.86 % |
| Parental protein coverage: | 54.97 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | QELTQNQVVLLDTLRQEISKFKECHS-MDXXXXFTEAKHYHTKLVNIRKEMLMLHEKTSKL-KIRALKLQ |
| QE..QNQ.VLLD.L.QEISKFKE.HS..D....F.E..HYHTKLVNIR.EM..L.E.TSK.......K.. | |
| Retrocopy | QEVIQNQAVLLDKLEQEISKFKERHSVLDINALFAEVQHYHTKLVNIREEMRVLYEETSKFXXXKRTKWS |
| Parental | QKRQK-EELEREQQREKEIEREKQLKN |
| ....K.EELERE.QR.KEIEREKQL.N | |
| Retrocopy | RRGRK<EELEREPQRRKEIEREKQLTN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 26 .84 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 7 .70 RPM |
| SRP012922_heart | 0 .00 RPM | 4 .41 RPM |
| SRP012922_kidney | 0 .00 RPM | 4 .38 RPM |
| SRP012922_liver | 0 .00 RPM | 4 .80 RPM |
| SRP012922_lung | 0 .00 RPM | 16 .04 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 5 .02 RPM |
| SRP012922_spleen | 0 .00 RPM | 17 .51 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012059 | 7 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000019785 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000007378 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013892 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012636 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005595 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017628 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017351 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013706 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000007310 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007038 | 1 retrocopy |