RetrogeneDB ID: | retro_dnov_2247 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_58145:4290..4617(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DNAJC24 | ||
Ensembl ID: | ENSDNOG00000013512 | ||
Aliases: | None | ||
Description: | DnaJ (Hsp40) homolog, subfamily C, member 24 [Source:HGNC Symbol;Acc:26979] |
Percent Identity: | 79.82 % |
Parental protein coverage: | 96.43 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | KQSTDVPAGAVEECIQKFIEIDQAWKILGNEETKK-EYDLQRHEDNLRNRGAIDAQVCLEDLSWNEDDDS |
.QS.DVPAGA.EECIQ.F..IDQAW.ILGNEE....EYDLQRHED.LRN.G.IDAQV.LE.L.WNEDD.S | |
Retrocopy | RQSADVPAGAIEECIQNFTRIDQAWEILGNEEXXXXEYDLQRHEDDLRNMGPIDAQVYLEELPWNEDDHS |
Parental | FSLSCRCGGKYSVSKDEAEEVNLISCDTCSLIIELLHYC |
FSLSCRCGGKYSVSKDEAEE.NLISCDTCS..IELLH.C | |
Retrocopy | FSLSCRCGGKYSVSKDEAEEINLISCDTCSRVIELLHHC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 2 .53 RPM |
SRP012922_cerebellum | 0 .00 RPM | 1 .79 RPM |
SRP012922_heart | 0 .00 RPM | 0 .70 RPM |
SRP012922_kidney | 0 .00 RPM | 1 .10 RPM |
SRP012922_liver | 0 .00 RPM | 1 .08 RPM |
SRP012922_lung | 0 .00 RPM | 1 .83 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 1 .38 RPM |
SRP012922_spleen | 0 .00 RPM | 2 .52 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000013512 | 1 retrocopy |
retro_dnov_2247 ,
|
Dipodomys ordii | ENSDORG00000000248 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000003054 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000007553 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000006845 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017878 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000007848 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000001638 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000003390 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000003471 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000009243 | 1 retrocopy |