RetrogeneDB ID: | retro_dnov_373 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_4186:107391..107708(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMEM230 | ||
Ensembl ID: | ENSDNOG00000005724 | ||
Aliases: | None | ||
Description: | transmembrane protein 230 [Source:HGNC Symbol;Acc:15876] |
Percent Identity: | 67.59 % |
Parental protein coverage: | 77.54 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | RLCQLVMMPS-RTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKSPPKIPYKAIALATVLFLIGAFLIIIG |
.LCQLV..PS..TNLATGIP.SKVK.SRLSS.DDGYIDLQFKKSPP..P.KA.ALA.VLF..GA.L..IG | |
Retrocopy | QLCQLVRLPS<STNLATGIPRSKVKCSRLSSPDDGYIDLQFKKSPPRLPSKALALAAVLFSVGALLAMIG |
Parental | SLLLAGYISKGGADRAVPVLIIGILVFLPGFYHLRIAY |
S....G......AD.AVPVLI.GI..FLP.F.HL.IAY | |
Retrocopy | S-SCGGRHHREEADLAVPVLIAGIQAFLPSFGHLHIAY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 20 .03 RPM |
SRP012922_cerebellum | 0 .27 RPM | 12 .23 RPM |
SRP012922_heart | 0 .00 RPM | 3 .94 RPM |
SRP012922_kidney | 0 .00 RPM | 19 .44 RPM |
SRP012922_liver | 0 .00 RPM | 9 .91 RPM |
SRP012922_lung | 0 .00 RPM | 22 .60 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 5 .19 RPM |
SRP012922_spleen | 0 .00 RPM | 22 .78 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009083 | 1 retrocopy | |
Bos taurus | ENSBTAG00000006063 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000006039 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000005724 | 5 retrocopies | |
Myotis lucifugus | ENSMLUG00000023089 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000008611 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000002863 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000019378 | 1 retrocopy |