RetrogeneDB ID: | retro_dnov_829 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_111796:2986..3401(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SRSF7 | ||
Ensembl ID: | ENSDNOG00000007821 | ||
Aliases: | None | ||
Description: | serine/arginine-rich splicing factor 7 [Source:HGNC Symbol;Acc:10789] |
Percent Identity: | 56.12 % |
Parental protein coverage: | 60.26 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | FDRPPARRPFDPND-RCYECGEKGHYAYDCHRYSRRRRSSSRSRSHSRSRRRRYSRSRSRSRGRRSRSVS |
FDRPPAR.PF.P...RCYECGEKGHYAYDCHRYS.R.RS.SRSR.HSR.R.R.YS.S.SRSRGRRSR..S | |
Retrocopy | FDRPPARCPFEPTC>RCYECGEKGHYAYDCHRYSQR*RSRSRSRWHSRARGR*YSHSGSRSRGRRSRPAS |
Parental | LRRSRSASLRRSRSGSIKGSRYFQSRSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPER |
...SRS..L.RSRS.S...SR...........S......RS........S...SRSP..S...S.SP.R | |
Retrocopy | PQLSRSVCLCRSRSASLRRSRSGSVKGLRYFQSQARPTSRSRSIS*PRDS*PNSRSPKRSHSPSGSPRR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 90 .43 RPM |
SRP012922_cerebellum | 0 .14 RPM | 65 .99 RPM |
SRP012922_heart | 0 .00 RPM | 19 .49 RPM |
SRP012922_kidney | 0 .00 RPM | 50 .38 RPM |
SRP012922_liver | 0 .00 RPM | 63 .63 RPM |
SRP012922_lung | 0 .31 RPM | 124 .16 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 14 .37 RPM |
SRP012922_spleen | 0 .00 RPM | 130 .83 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015988 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000029620 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000000421 | 9 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007821 | 2 retrocopies |
retro_dnov_317, retro_dnov_829 ,
|
Dasypus novemcinctus | ENSDNOG00000012598 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000016459 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000009536 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000008669 | 1 retrocopy | |
Mus musculus | ENSMUSG00000024097 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000010169 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000027360 | 11 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000015970 | 1 retrocopy |