RetrogeneDB ID: | retro_dnov_829 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_111796:2986..3401(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRSF7 | ||
| Ensembl ID: | ENSDNOG00000007821 | ||
| Aliases: | None | ||
| Description: | serine/arginine-rich splicing factor 7 [Source:HGNC Symbol;Acc:10789] |
| Percent Identity: | 56.12 % |
| Parental protein coverage: | 60.26 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | FDRPPARRPFDPND-RCYECGEKGHYAYDCHRYSRRRRSSSRSRSHSRSRRRRYSRSRSRSRGRRSRSVS |
| FDRPPAR.PF.P...RCYECGEKGHYAYDCHRYS.R.RS.SRSR.HSR.R.R.YS.S.SRSRGRRSR..S | |
| Retrocopy | FDRPPARCPFEPTC>RCYECGEKGHYAYDCHRYSQR*RSRSRSRWHSRARGR*YSHSGSRSRGRRSRPAS |
| Parental | LRRSRSASLRRSRSGSIKGSRYFQSRSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPER |
| ...SRS..L.RSRS.S...SR...........S......RS........S...SRSP..S...S.SP.R | |
| Retrocopy | PQLSRSVCLCRSRSASLRRSRSGSVKGLRYFQSQARPTSRSRSIS*PRDS*PNSRSPKRSHSPSGSPRR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 90 .43 RPM |
| SRP012922_cerebellum | 0 .14 RPM | 65 .99 RPM |
| SRP012922_heart | 0 .00 RPM | 19 .49 RPM |
| SRP012922_kidney | 0 .00 RPM | 50 .38 RPM |
| SRP012922_liver | 0 .00 RPM | 63 .63 RPM |
| SRP012922_lung | 0 .31 RPM | 124 .16 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 14 .37 RPM |
| SRP012922_spleen | 0 .00 RPM | 130 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015988 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000029620 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000421 | 9 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007821 | 2 retrocopies |
retro_dnov_317, retro_dnov_829 ,
|
| Dasypus novemcinctus | ENSDNOG00000012598 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000016459 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009536 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000008669 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024097 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010169 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000027360 | 11 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000015970 | 1 retrocopy |