RetrogeneDB ID: | retro_dnov_875 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_1169:226164..226489(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CBY1 | ||
Ensembl ID: | ENSDNOG00000010982 | ||
Aliases: | None | ||
Description: | chibby homolog 1 (Drosophila) [Source:HGNC Symbol;Acc:1307] |
Percent Identity: | 56.76 % |
Parental protein coverage: | 85.83 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 2 |
Parental | SASLSNLHSLDRSTRDVELGLDYGT-PTMNLAGQSLKFENGQWIAETGISGGVDRR-EAQRLRRRNQQLE |
S..L.NLHSL.RST...EL.LD.G...T...AGQSL..ENGQWI..T.I..G.D.R.E.......NQ.LE | |
Retrocopy | SQPL*NLHSLNRSTQENELDLDFGS<STIIQAGQSLTSENGQWISDTWIGEGTDGR<ET*HIHGQNQRLE |
Parental | EENNLLRLKVDILLDMLSETTAESHLMEKELDELKSINRRR |
E.NN.L.LKVDILL.M...TT.E.HLM.KE.D.LKS...RR | |
Retrocopy | ETNNQL*LKVDILLNMQPGTTVELHLMGKE*DKLKSFTSRR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 2 .92 RPM |
SRP012922_cerebellum | 0 .00 RPM | 11 .27 RPM |
SRP012922_heart | 0 .00 RPM | 3 .71 RPM |
SRP012922_kidney | 0 .00 RPM | 5 .75 RPM |
SRP012922_liver | 0 .00 RPM | 1 .24 RPM |
SRP012922_lung | 0 .00 RPM | 6 .11 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 2 .25 RPM |
SRP012922_spleen | 0 .00 RPM | 4 .81 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000001384 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000010982 | 1 retrocopy |
retro_dnov_875 ,
|
Homo sapiens | ENSG00000100211 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013226 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003757 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000013150 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015153 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000028533 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014373 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000001484 | 1 retrocopy |