RetrogeneDB ID: | retro_nleu_349 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397263.1:17275366..17275600(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CBY1 | ||
Ensembl ID: | ENSNLEG00000015153 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 65.38 % |
Parental protein coverage: | 60.8 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | QSLKFENGQWIAETGVSGGVDRREVQRLQAEP-AVEEENNLLRLKVDILLDMLSESTAESHLMEKELDEL |
.S.KFENG.WI.ETG.SGGVDRRE.Q.L.......EEEN.LL.LKVDILLDM.SE.TA.S.LMEKELD.. | |
Retrocopy | RSQKFENGRWIPETGSSGGVDRREAQCLHRQN*QLEEENSLLQLKVDILLDMFSETTAKSLLMEKELDAR |
Parental | R-ISRKRK |
...S..RK | |
Retrocopy | KSVSQGRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000001384 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000010982 | 1 retrocopy | |
Homo sapiens | ENSG00000100211 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013226 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003757 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000013150 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015153 | 1 retrocopy |
retro_nleu_349 ,
|
Otolemur garnettii | ENSOGAG00000028533 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014373 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000001484 | 1 retrocopy |