RetrogeneDB ID: | retro_ggor_1781 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 2b:61359542..61359776(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CBY1 | ||
Ensembl ID: | ENSGGOG00000013226 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 71.79 % |
Parental protein coverage: | 61.11 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | QSLKFENGQWIAETGVSGGVDRREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDEL |
QS.KFENG.WIAET..SGGVDRRE.Q.L.R.N.QLEEEN.LL.LKVDILLDM.SE.TA.S.LMEKELD.. | |
Retrocopy | QSQKFENGWWIAETAISGGVDRREAQCLHRQN*QLEEENSLLQLKVDILLDMFSETTAKSLLMEKELDAW |
Parental | R-ISRKRK |
...S..RK | |
Retrocopy | KSVSQRRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 19 .52 RPM |
SRP007412_cerebellum | 0 .00 RPM | 18 .40 RPM |
SRP007412_heart | 0 .00 RPM | 17 .39 RPM |
SRP007412_kidney | 0 .00 RPM | 25 .19 RPM |
SRP007412_liver | 0 .00 RPM | 13 .24 RPM |
SRP007412_testis | 0 .00 RPM | 22 .07 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2344 |
Pan troglodytes | retro_ptro_1716 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000001384 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000010982 | 1 retrocopy | |
Homo sapiens | ENSG00000100211 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013226 | 1 retrocopy |
retro_ggor_1781 ,
|
Myotis lucifugus | ENSMLUG00000003757 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000013150 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015153 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000028533 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014373 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000001484 | 1 retrocopy |